PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 156aa    MW: 18198.9 Da    PI: 9.7822
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496299.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.66.5e-131050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i +++ r+ ++ kR++g +KK +EL +LC++ ++ ii s+
  XP_004496299.1 10 FITDDTARKASYNKRKKGFIKKVNELTTLCGIPACAIISSP 50
                    799***********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.85E-22182IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.194149IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-19160IPR002100Transcription factor, MADS-box
CDDcd002667.65E-22284No hitNo description
PRINTSPR004048.3E-6323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-131050IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MTRRKVKLAF ITDDTARKAS YNKRKKGFIK KVNELTTLCG IPACAIISSP FDTQPEVWPN  60
PEGARKVIER YQNSSVIDET RNVNQETFIM QRIAKARDQL RKQKHDNREQ ELNLLMFGFM  120
QSNILSDDLT AEELKDFDKL IEKKMREVDN KFATLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496299.11e-113PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLG7JY856e-76G7JY85_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA10G28320.13e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13237929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-40AGAMOUS-like 80